SLC22A7 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7.Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEER
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC22A7
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
Alternate Names for SLC22A7 Antibody
- hOAT2
- liver-specific transporter
- NLTMGC45202
- Novel liver transporter
- OAT2MGC24091
- Organic anion transporter 2
- solute carrier family 22 (organic anion transporter), member 7
- solute carrier family 22 member 7