SLC22A7 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7.Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEER
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC22A7
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLC22A7 Antibody
- hOAT2
- liver-specific transporter
- NLTMGC45202
- Novel liver transporter
- OAT2MGC24091
- Organic anion transporter 2
- solute carrier family 22 (organic anion transporter), member 7
- solute carrier family 22 member 7
Background
SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.