Recombinant Human GLG1, N-His
Name : Recombinant Human GLG1, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q92896
Synonyms :
Recombinant Human GLG1, N-His
Amino Acid Sequence :
Molecular Weight :
13.31 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human GLG1(Lys1048-Asn1145) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
176161-24-3 custom synthesis 82-08-6 Formula PMID:30000594 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Product Name :
Recombinant Homo sapiens CMRF35-like molecule 7
Brief Description :
Recombinant Protein
Accession No. :
A8K4G0
Calculated MW :
17.2 kDa
Target Sequence :
IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
A8K4G0
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
PARG Antibody In stock CD276 Antibody manufacturer PMID:34850638 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Name : Recombinant Human FTMT, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q8N4E7
Synonyms :
Recombinant Human FTMT, N-His
Amino Acid Sequence :
Molecular Weight :
24.36 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human FTMT(Leu49-Asn242) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
50-35-1 References 59-67-6 Description PMID:30664110 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Product Name :
Recombinant Human Proto-oncogene c-Rel(REL),partial
Brief Description :
Recombinant Protein
Accession No. :
Q04864
Calculated MW :
71.9 kDa
Target Sequence :
SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q04864
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
ALG2 Antibody manufacturer 7-Aminoheptanoic acid PROTAC PMID:34856296 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Name : Recombinant Human CRY1, N-GST
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q16526
Synonyms :
Recombinant Human CRY1, N-GST
Amino Acid Sequence :
Molecular Weight :
41.80 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human CRY1(Val3-Leu132) was fused with the N-GST Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
90-33-5 supplier 72741-87-8 Description PMID:30725923 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Product Name :
Recombinant human 5′-nucleotidase
Brief Description :
Recombinant Protein
Accession No. :
P21589
Calculated MW :
84.6 kDa
Target Sequence :
ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYPAVEGRIK
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P21589
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Allicin medchemexpress Pyridine-3-sulfonyl custom synthesis PMID:34719282 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Name : Recombinant Human KEAP1, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q14145
Synonyms :
Recombinant Human KEAP1, N-His
Amino Acid Sequence :
Molecular Weight :
20.37 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human KEAP1(Ala90-Ile250) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
203787-91-1 site 113559-13-0 custom synthesis PMID:25905330 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Product Name :
Recombinant human Inosine-5′-monophosphate dehydrogenase 2
Brief Description :
Recombinant Protein
Accession No. :
P12268
Calculated MW :
82.3 kDa
Target Sequence :
LISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P12268
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CD107b Antibody In Vitro SLC22A12 Antibody Autophagy PMID:33983470 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Name : Recombinant Human ICA1, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q05084
Synonyms :
Recombinant Human ICA1, N-His
Amino Acid Sequence :
Molecular Weight :
32.55 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human ICA1(Met1-Gly258) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
152-11-4 custom synthesis 35604-67-2 site PMID:31082144 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Product Name :
Recombinant human Tumor necrosis factor ligand superfamily member 13B
Brief Description :
Recombinant Protein
Accession No. :
Q9Y275
Calculated MW :
39.7 kDa
Target Sequence :
QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q9Y275
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Xanthine oxidase site 1,3-Diiodopropane Epigenetics PMID:34918302 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com