Kv12.2 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSS SSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
KCNH3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for Kv12.2 Antibody
- BEC1
- brain-specific eag-like channel 1
- ELK channel 2
- ELK2
- ether-a-go-go K(+) channel family member
- ether-a-go-go-like potassium channel 2
- KIAA1282
- Kv12.2
- potassium voltage-gated channel subfamily H member 3
- potassium voltage-gated channel, subfamily H (eag-related), member 3
- voltage-gated potassium channel subunit Kv12.2