Periostin/OSF-2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to POSTN (periostin, osteoblast specific factor) The peptide sequence was selected from the N terminal of POSTN (NP_006466) and is located within the following region: RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
POSTN
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
From PBS.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
Alternate Names for Periostin/OSF-2 Antibody
- Fasciclin I-like
- MGC119510
- MGC119511
- OSF2
- OSF-2
- OSF-2osteoblast specific factor 2 (fasciclin I-like)
- OSF2periodontal ligament-specific periostin
- Osteoblast-specific factor 2
- PDLPOSTN
- periostin isoform thy2
- periostin isoform thy4
- periostin isoform thy6
- periostin isoform thy8
- Periostin
- periostin, osteoblast specific factor
- PNRP11-412K4.1
- POSTN
- TRIF52