vasorin

pyruvate-dehydrogenase inhibitor

Product Name :
vasorin

Target gene :
VASN

verified_species_reactivity :
Human

interspecies_information :
86%, ENSMUSG00000039646, species_id: MOUSE, 90%, ENSRNOG00000004141, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
LDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCPATTTTATVPTTRPVVREPTALSSSLAPT

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000168140

Entrez :
114990

UniProt :
Q6EMK4

Dilution:

Retrieval method :

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
154523-54-3 SMILES 352431-30-2 InChIKey PMID:30422470 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Related Posts

S brain may well be characterized by a larger content of dopamine

S brain may be characterized by a larger content material of dopamine in DNs. Hence, the variability of dopamine levels previously reported in distinct samples may well reflect the age and regional variations in the distribution of DNs inside the brain in sufferers with DS. Potential molecules connected with this variability could be upregulated DAT1 […]

An basilar motion, based on the cell’s RC time constant.

An basilar motion, based on the cell’s RC time constant. This problem has been addressed by many investigators, and many ostensible resolutions to the RC time-constant problem have been proposed (15,25,59?2). However, we must now consider the slow kinetics of prestin at physiological chloride levels that we have uncovered. This can only make matters worse. […]

Or increasing awareness of and access to resources needed to prevent

Or increasing awareness of and access to resources needed to prevent infection or provide testing or care for the infected. In general, such efforts require a significant and long-term commitment of resources to achieve measurable outcomes. In some cases, because of the complex inputs in multilevel or structural interventions and the potential for numerous unanticipated […]