neurofascin

pyruvate-dehydrogenase inhibitor

Product Name :
neurofascin

Target gene :
NFASC

verified_species_reactivity :
Human

interspecies_information :
98%, ENSMUSG00000026442, species_id: MOUSE, 98%, ENSRNOG00000030515, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFE

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000163531

Entrez :
23114

UniProt :
O94856

Dilution:
1:50 – 1:200

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
177332-37-5 Data Sheet 33419-42-0 medchemexpress PMID:25905292 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Related Posts

And integrated, in 12 multiplexes, a total of 107 somatic mutations

And integrated, in 12 multiplexes, a total of 107 somatic mutations in 15 genes. These two panels integrated 49 additional positions in 6 further genes. Thus, a total of 287 distinct positions in 25 oncogenes were checked (See Supplementary Table S4).(Prometeo/2013/005); and Tangeretin Fondos FEDER. MI-V is funded by the Ministerio de Salud Carlos III […]

Rt were greater than in PsA (P = 0.017). There was a significantRt were greater

Rt were greater than in PsA (P = 0.017). There was a significantRt were greater than in PsA (P = 0.017). There was a significant correlation PubMed ID:https://www.ncbi.nlm.nih.gov/pubmed/25636517 and IMT in the different subgroups or in patients with an increased IMT. Conclusions Patients with inflammatory arthritis (RA > PsA) are at a greater risk of […]