MBD3 (Human) Recombinant Protein (P01)

Name :
MBD3 (Human) Recombinant Protein (P01)

Biological Activity :
Human MBD3 full-length ORF ( NP_003917.1, 1 a.a. – 291 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_003917.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=53615

Amino Acid Sequence :
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV

Molecular Weight :
59.2

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (95); Rat (95)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
MBD3

Gene Alias :

Gene Description :
methyl-CpG binding domain protein 3

Gene Summary :
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3. MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex. [provided by RefSeq

Other Designations :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Activin RIB/ALK-4 Proteinweb
FGF-10 ProteinSpecies
Popular categories:
IL-1 Rrp2
Nemo Like Kinase