G patch domain and KOW motifs

August 3, 2025 pyruvate-dehydrogenase inhibitor

Product Name :
G patch domain and KOW motifs

Target gene :
GPKOW

verified_species_reactivity :
Human

interspecies_information :
77%, ENSMUSG00000031148, species_id: MOUSE, 79%, ENSRNOG00000022939, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEA

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000068394

Entrez :
27238

UniProt :
Q92917

Dilution:
1:20 – 1:50

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
83-46-5 Formula 65725-11-3 Molecular Weight PMID:28045373 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Ype and the effectiveness of therapy BTLA/CD272 Proteins supplier within this case is oftenYpe as

Ype and the effectiveness of therapy BTLA/CD272 Proteins supplier within this case is oftenYpe as well as the effectiveness of therapy within this case can be achieved making use of 16-membered lactone ring macrolides, clindamycin, and streptogramin A. The MSB type of resistance is regulated inductively. The inducers are 14- and 15-membered macrolides and resistance […]

chromosome 5 open reading frame 34

Product Name : chromosome 5 open reading frame 34Target gene : C5orf34verified_species_reactivity : Humaninterspecies_information : 74%, ENSMUSG00000062822, species_id: MOUSE, 76%, ENSRNOG00000017581, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.purification_method : Affinity purified using the PrEST antigen as affinity ligandantigen_sequence : LSLSHNYRICCWKMVPGINDSNILPLVLKESLIPSVGRFLAYSDDKVHAIFLDGITLTLNWNFSSPIEKRQVNQGLNLGWCKLTFPDGQEQLIQIEHPEPreferences […]

An accurate measure of the half-life of GFP-SRE+ mRNA can be

An accurate measure of the half-life of GFP-SRE+ mRNA can be found in Figure S2. doi:10.1371/journal.pone.0047121.gEap1p Functions in Vts1p-Mediated Transcript DecayFigure 2. Eap1p is required for the destabilization of GFP-YIR016W mRNA. mRNA expression was MedChemExpress PD168393 induced in the indicated strains and then shut-off with glucose and reporter mRNA levels were assayed at the times […]

Related Posts