family with sequence similarity 167, member A

pyruvate-dehydrogenase inhibitor

Product Name :
family with sequence similarity 167, member A

Target gene :
FAM167A

verified_species_reactivity :
Human

interspecies_information :
93%, ENSMUSG00000035095, species_id: MOUSE, 91%, ENSRNOG00000011316, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
LRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFS

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000154319

Entrez :
83648

UniProt :
Q96KS9

Dilution:
1:20 – 1:50

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
33419-42-0 site 42424-50-0 site PMID:30252298 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Related Posts

Der variations in cultural background. Nonetheless, the limitations open avenues forDer variations in cultural background.

Der variations in cultural background. Nonetheless, the limitations open avenues forDer variations in cultural background. Nonetheless, the limitations open avenues for many intriguing possibilities for future research. For instance, researchers may possibly evaluate the significance of other danger constructs in individuals’ overall perceived danger, because the dimensions that have been evaluated within this study explained […]

Zoonotic Influenza Virus

Ical libraries tends to consist of weighty tomes which are typical texts for the specialist and also a motley selection of layperson’s guides on tips on how to cope with neurological disability. Nothing at all wrong with either, but there is certainly surely area for any meeting of minds within the strategy to neurological practice. […]

E V = V . The device exhibthe drain current of 1 mA/mmE V =

E V = V . The device exhibthe drain current of 1 mA/mmE V = V . The device exhibthe drain existing of 1 mA/mm and also the ramping situations are Vdd= Vgg.The device exhibited a saturated drain current of 1.43 A/mm at VGS = 4 V and VDS = 10 V. The saturation ited […]