TIMELESS interacting protein

pyruvate-dehydrogenase inhibitor

Product Name :
TIMELESS interacting protein

Target gene :
TIPIN

verified_species_reactivity :
Human

interspecies_information :
66%, ENSMUSG00000032397, species_id: MOUSE, 59%, ENSRNOG00000043068, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000075131

Entrez :
54962

UniProt :
Q9BVW5

Dilution:
1:2500 – 1:5000

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
76343-93-6 web 31430-18-9 medchemexpress PMID:28796472 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Related Posts

Orm of mobile dying in all animals along with a typical goal for tumorigenesis [63].

Orm of mobile dying in all animals along with a typical goal for tumorigenesis [63]. Caspase-associated induction of apoptosis-like attributes seems to generally be an early nsPEF-induced mechanism that correlates with melanoma tumor ��-Boswellic acid In Vivo demise as indicated by activation of executioner caspases, which continue to be active 2 hrs immediately after Smilagenin […]

1177/1754073913477505. ?Eder, A. B., Musseler, J., Hommel, B. (2012). The structure of affective

1177/1754073913477505. ?Eder, A. B., Musseler, J., Hommel, B. (2012). The structure of affective action representations: temporal binding of affective response codes. Psychological Research, 76, 111?18. doi:10. 1007/s00426-011-0327-6. Eder, A. B., Rothermund, K., De Houwer, J., Hommel, B. (2015). Directive and incentive functions of affective action consequences: an ideomotor strategy. Psychological Investigation, 79, 630?49. doi:ten.1007/s00426-014-0590-4. Elsner, […]

UC-112

Product Name : UC-112Description:UC-112 is an IAP inhibitor. It acts by suppressing X-linked inhibitor of apoptosis protein (XIAP) and survivin levels, inhibiting the growth of P-glycoproteins, and activating caspase-3/7 and caspase-9.CAS: 383392-66-3Molecular Weight:348.44Formula: C22H24N2O2Chemical Name: 5-[(benzyloxy)methyl]-7-[(pyrrolidin-1-yl)methyl]quinolin-8-olSmiles : OC1=C2N=CC=CC2=C(COCC2C=CC=CC=2)C=C1CN1CCCC1InChiKey: LTGLGIQQZXSLLF-UHFFFAOYSA-NInChi : InChI=1S/C22H24N2O2/c25-22-18(14-24-11-4-5-12-24)13-19(20-9-6-10-23-21(20)22)16-26-15-17-7-2-1-3-8-17/h1-3,6-10,13,25H,4-5,11-12,14-16H2Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as […]