thrombospondin 2

pyruvate-dehydrogenase inhibitor

Product Name :
thrombospondin 2

Target gene :
THBS2

verified_species_reactivity :
Human

interspecies_information :
76%, ENSMUSG00000023885, species_id: MOUSE, 75%, ENSRNOG00000010529, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
HVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSNDNQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCP

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000186340

Entrez :
7058

UniProt :
P35442

Dilution:

Retrieval method :

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
1337531-36-8 References 1445700-01-5 supplier PMID:25905294 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Related Posts

E of their method may be the additional computational burden resulting from

E of their method will be the further computational burden resulting from permuting not merely the class labels but all genotypes. The internal validation of a model primarily based on CV is computationally costly. The original description of MDR suggested a APD334 web 10-fold CV, but Motsinger and Ritchie [63] analyzed the influence of eliminated […]

Er amounts indicating that personal gain was prioritized over Receiver’s

Er amounts indicating that personal gain was prioritized over Receiver’s pain). The task comprised a series of eight screens per trial across 20 trials. Each trial began with a screen displaying the running amount of the subject’s bank total (?0 on Trial 1) and current trial LOR-253 biological activity number. Subjects then had up to […]

Uld look like or which subgroup of cell membrane proteins it need to belong to.

Uld look like or which subgroup of cell membrane proteins it need to belong to. We don’t even have suitable tools/models to assess the targets/agents appropriately. The truth that the majority of the priority proteins in the NCI listing belong for the TKR subgroup signifies that these receptors are apparently suited for targeted therapy and/or […]