TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa

pyruvate-dehydrogenase inhibitor

Product Name :
TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa

Target gene :
TAF1D

verified_species_reactivity :
Human

interspecies_information :
61%, ENSMUSG00000031939, species_id: MOUSE, 57%, ENSRNOG00000010921, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
ESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDIT

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000166012

Entrez :
79101

UniProt :
Q9H5J8

Dilution:
1:2500 – 1:5000

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
253128-41-5 Purity 1242137-15-0 References PMID:20301510 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Related Posts

conclusion, we discovered that fungus-fungus coculturing could activate the silent tenS gene cluster in B.

conclusion, we discovered that fungus-fungus coculturing could activate the silent tenS gene cluster in B. bassiana to generate the iron-chelating 2-pyridones to advantage the generating fungus to compete for diverse niches. The biosynthetic mechanism of tenellin derivatives is significantly expanded with the identification in the pathway-specific regulator plus the nonclustered genes involved in the methylglucosylation […]

Sing of faces which might be represented as action-outcomes. The present demonstration

Sing of faces that happen to be represented as action-outcomes. The present demonstration that implicit motives predict actions after they’ve come to be associated, by indicates of action-outcome mastering, with faces differing in dominance level concurs with proof collected to test central aspects of motivational field theory (Stanton et al., 2010). This theory argues, amongst […]

Ive . . . four: Confounding aspects for men and women with ABI1: Beliefs for

Ive . . . four: Confounding aspects for men and women with ABI1: Beliefs for social care Disabled people today are vulnerable and need to be taken care of by educated professionalsVulnerable men and women will need Executive impairments safeguarding from jir.2014.0227 lives services have a duty for many people with make certain equality for […]