Sp2 transcription factor

pyruvate-dehydrogenase inhibitor

Product Name :
Sp2 transcription factor

Target gene :
SP2

verified_species_reactivity :
Human

interspecies_information :
86%, ENSMUSG00000018678, species_id: MOUSE, 89%, ENSRNOG00000010492, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSST

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000167182

Entrez :
6668

UniProt :
Q02086

Dilution:
1:20 – 1:50

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
79902-63-9 custom synthesis 1320346-97-1 medchemexpress PMID:30521222 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Related Posts

E EP band and the HW band give narrower intervals for

E EP band and the HW band give narrower intervals for the middle portion of the data range than the piecewise Cox model. Near the end of the data range, all 3 bands have about the same width as the confidence interval from Prentice and others (2005). Overall the EP band matches most closely with […]

Inically significant levels of externalizing behaviors, with aggression and delinquency most

Inically significant levels of externalizing behaviors, with aggression and delinquency most commonly identified (Dubowitz et al., 1994), and African American and white males in kinship care have been found to be at greatest risk for Oxaliplatin site juvenile delinquency (Ryan, Hong, Herz, Hernandez, 2010). In regards to internalizing problems kinship foster youth reported experiencing greater […]

Dation. The typical functioning options of LMS, MBZ, HMBZ, and AMBZ have been diluted with

Dation. The typical functioning options of LMS, MBZ, HMBZ, and AMBZ have been diluted with suitable amounts of diverse blank poultry muscle matrix extracts into six distinct series of concentrations, and the ready mixed typical working options have been analyzed by HPLC-MS/MS in AGI-43192 Cancer sequence and five times at each and every DQP-1105 Epigenetic […]