slit homolog 2 (Drosophila)

pyruvate-dehydrogenase inhibitor

Product Name :
slit homolog 2 (Drosophila)

Target gene :
SLIT2

verified_species_reactivity :
Human

interspecies_information :
94%, ENSMUSG00000031558, species_id: MOUSE, 97%, ENSRNOG00000003840, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
LYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLE

references :

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000145147

Entrez :
9353

UniProt :
O94813

Dilution:
1:50 – 1:200

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
2444815-84-1 Technical Information 2253733-10-5 Technical Information PMID:27891836 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Related Posts

Anti-GFP, AlpSdAbs® VHH(iFluor594)

Product Name : Anti-GFP, AlpSdAbs® VHH(iFluor594)Applications: ELISA,ICC/IF,Flow CytReactivity : GFPConjugate:iFluor594Advantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-GFP, AlpSdAbs® VHH(iFluor594) is designed for detecting GFP fusion proteins. Anti-GFP, AlpSdAbs® VHH(iFluor594) is based on monoclonal, recombinant, single domain antibody to GFP coupled to iFluor594 . Based on immunoelectrophoresis and/or ELISA, Anti-GFP, AlpSdAbs® […]

Ed in feedlot rearing practice [8]. Nonetheless, there is certainly little info onEd in feedlot

Ed in feedlot rearing practice [8]. Nonetheless, there is certainly little info onEd in feedlot rearing practice [8]. Nonetheless, there’s small details around the natural occurrence of mycotoxins in natural grasses (uncultivated) devoted to cattle grazing. Of distinct concern towards the Argentinean livestock business is the fact that zearalenone is chemically comparable towards the development […]