GH1 (Bovine) Recombinant Protein

Name :
GH1 (Bovine) Recombinant Protein

Biological Activity :
Bovine GH1 recombinant protein expressed in?Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P01246

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=280804

Amino Acid Sequence :
AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETMPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRRGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF

Molecular Weight :
21.8

Storage and Stability :
Lyophilized protein at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
chromatographic

Quality Control Testing :

Storage Buffer :
Protein (1 mg/mL) was lyophilized from a solution containing 4.5 mM NaHCO3, pH 8-9. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.

Applications :
Functional Study,

Gene Name :
GH

Gene Alias :

Gene Description :
growth hormone

Gene Summary :

Other Designations :
growth hormone 1

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD14 ProteinSource
IL-23 Recombinant Proteins
Popular categories:
Protein tyrosine phosphatases
Integrin alpha 6 beta 4