Name :
IL3 (Human) Recombinant Protein
Biological Activity :
Human IL3 (P08700, 20 a.a. – 152 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P08700
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3562
Amino Acid Sequence :
APAPTTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Molecular Weight :
15
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
insect
Interspecies Antigen Sequence :
Preparation Method :
Sf9 cell expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water is > 100 ug/mL
Applications :
Functional Study, SDS-PAGE,
Gene Name :
IL3
Gene Alias :
IL-3, MCGF, MGC79398, MGC79399, MULTI-CSF
Gene Description :
interleukin 3 (colony-stimulating factor, multiple)
Gene Summary :
The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq
Other Designations :
P-cell stimulating factor|hematopoietic growth factor|interleukin 3|mast-cell growth factor|multilineage-colony-stimulating factor
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-7 Recombinant Proteins
IL-1 alpha ProteinFormulation
Popular categories:
Siglec-9
Cathepsin F