Name :
CD200r1 (Mouse) Recombinant Protein
Biological Activity :
Mouse CD200r1 (Q9ES57, 261 a.a. – 238 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of bioactivity analysis
Protein Accession No. :
Q9ES57
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=57781
Amino Acid Sequence :
TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP
Molecular Weight :
50.4
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Viruses
Interspecies Antigen Sequence :
Preparation Method :
Baculovirus expression system
Purification :
Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer :
In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Applications :
Functional Study, SDS-PAGE,
Gene Name :
CD200r1
Gene Alias :
CD200R, Mox2r, OX2R
Gene Description :
CD200 receptor 1
Gene Summary :
Other Designations :
OTTMUSP00000030764|Orexin receptor 2|antigen identified by monoclonal antibody MRC OX-2 receptor
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF ProteinMedChemExpress
IFN-gamma ProteinGene ID
Popular categories:
IL-10R beta
LI-Cadherin/Cadherin-17