Retnlb (Mouse) Recombinant Protein

pyruvate-dehydrogenase inhibitor

Name :
Retnlb (Mouse) Recombinant Protein

Biological Activity :
Mouse Retnlb (Q99P86) recombinant protein expressed in Escherichia coli.

Tag :

Protein Accession No. :
Q99P86

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=57263

Amino Acid Sequence :
MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA

Molecular Weight :
8.9

Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditionsLane 2: reducing conditions

Storage Buffer :
No additive

Applications :
SDS-PAGE，

Gene Name :
Retnlb

Gene Alias :
9030012B21Rik, Fizz2, RELMbeta, Relmb, Xcp3

Gene Description :
resistin like beta

Gene Summary :

Other Designations :
found in inflammatory zone 2|resistin-like molecule beta

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF-1 Proteinsupplier
LDHA Proteinmedchemexpress
Popular categories:
Inhibin Subunit Beta C (INHBC)
Serpin (Protease Inhibitor)

Related Posts

Tudies Molecular docking was employed to evaluate the affinity of yourTudies Molecular docking was employed

Tudies Molecular docking was employed to evaluate the affinity of yourTudies Molecular docking was employed to evaluate the affinity from the binding of D. orbita secondary metabolites Propiconazole NF-��B towards cyclooxygenase isoform COX-1 and COX-2 binding web-sites. Glide versatile ligand docking was utilised right here for docking studies [150,151], within which penalties have been implemented […]

Chain amino acid Non-preferred amino acid Non-preferred amino acid Non-preferred amino

Chain amino acid Non-preferred amino acid Non-preferred amino acid Non-preferred amino acid Non-preferred amino acid Non-preferred amino acid Non-preferred amino acid Non-preferred amino acidsimilar structure to valine. The pH on the PAA-supplemented wort was adjusted to that on the handle wort with 90 lactic acid (Merck KGaA, Germany). Yeast propagation was carried out primarily as […]

On [15], categorizes unsafe acts as slips, lapses, rule-based mistakes or knowledge-based

On [15], categorizes unsafe acts as slips, lapses, rule-based errors or knowledge-based blunders but importantly requires into account specific `error-producing conditions’ that may well predispose the prescriber to generating an error, and `latent conditions’. These are generally design and style srep39151 troubles. Reason’s model also describes `latent conditions’ which, even though not a direct result […]