mediator of cell motility 1 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MEMO1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for mediator of cell motility 1 Antibody
- C21orf19-like protein
- C2orf4DKFZp434I0135
- CGI-27
- FLJ25031
- HCV NS5A-transactivated protein 7
- Hepatitis C virus NS5A-transactivated protein 7
- mediator of cell motility 1
- Mediator of ErbB2-driven cell motility 1
- memo-1
- MEMOchromosome 2 open reading frame 4
- NS5ATP7
- protein MEMO1