eEF1A1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
EEF1A1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for eEF1A1 Antibody
- CCS3
- CCS-3
- cervical cancer suppressor 3
- CTCL tumor antigen
- EE1A1
- EEF-1
- EEF1A
- eEF1A-1
- EF1AHNGC:16303
- EF1a-like protein
- EF-1-alpha-1
- EF-Tu
- elongation factor 1 alpha subunit
- elongation factor 1-alpha 1
- Elongation factor Tu
- Eukaryotic elongation factor 1 A-1
- eukaryotic translation elongation factor 1 alpha 1
- eukaryotic translation elongation factor 1 alpha 1-like 14
- FLJ25721
- glucocorticoid receptor AF-1 specific elongation factor
- GRAF-1EF
- LENG7
- leukocyte receptor cluster (LRC) member 7
- Leukocyte receptor cluster member 7
- MGC102687
- MGC131894
- MGC16224
- prostate tumor-inducing protein 1
- PTI1
- translation elongation factor 1 alpha 1-like 14