Product: MAL-di-EG-Val-Cit-PAB-MMAE
ZNF346 Antibody Summary
| Immunogen |
Recombinant protein encompassing a sequence within the center region of human ZNF346. The exact sequence is proprietary.
|
| Localization |
Nucleus, nucleolus, Cytoplasm
|
| Predicted Species |
Porcine (94%), Bovine (94%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ZNF346
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:1000-1:10000
- Immunohistochemistry 1:100-1:1000
- Immunohistochemistry-Paraffin 1:100-1:1000
|
| Theoretical MW |
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
0.1M Tris (pH 7.0), 0.1M Glycine and 10% Glycerol
|
| Preservative |
0.01% Thimerosal
|
| Concentration |
1 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for ZNF346 Antibody
Background
The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA binding, but are also required for its nucleolar localization. The encoded protein may be involved in cell growth and survival. [provided by RefSeq]
PMID: 10728876
Product: Tetrahydrocoptisine
ZNF346 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:LMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTL
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ZNF346
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100 – 1:250
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 – 1:200
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
| Control Peptide |
| ZNF346 Protein (NBP1-83084PEP) |
|
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for ZNF346 Antibody
PMID: 26132492
Product: Tubastatin A (Hydrochloride)
ZNF346 Antibody Summary
| Immunogen |
ZNF346 (NP_036411.1, 1 a.a. ~ 294 a.a) full-length human protein.MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQ
|
| Specificity |
ZNF346 – zinc finger protein 346,
|
| Clonality |
Polyclonal
|
| Host |
Mouse
|
| Gene |
ZNF346
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:500
- ELISA
- Immunocytochemistry/Immunofluorescence
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
Protein A purified
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ZNF346 Antibody
Background
The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA binding, but are also required for its nucleolar localization. The encoded protein may be involved in cell growth and survival. [provided by RefSeq]
PMID: 11416012