VTA1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAE
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
VTA1
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
| Control Peptide |
|
Reactivity Notes
Mouse 84%, Rat 87%
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for VTA1 Antibody
- C6orf55DRG1
- Dopamine-responsive gene 1 protein
- DRG-1
- FLJ27228
- homolog of mouse SKD1-binding protein 1
- LIP5HSPC228
- LYST-interacting protein 5
- My012
- SBP1chromosome 6 open reading frame 55
- SKD1-binding protein 1
- vacuolar protein sorting-associated protein VTA1 homolog
- Vps20-associated 1 homolog (S. cerevisiae)