Product: Tos-Gly-Pro-Arg-ANBA-IPA
USH1C Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:LVGDLKLVINEPSRLPLFDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLI
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
USH1C
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for USH1C Antibody
- AIE75
- AIE-75
- Antigen NY-CO-38/NY-CO-37
- Autoimmune enteropathy-related antigen AIE-75
- deafness, autosomal recessive 18
- DFNB18
- harmonin
- NY-CO-37
- NY-CO-38
- PDZ-45
- PDZ73
- PDZ-73
- PDZ-73/NY-CO-38
- Protein PDZ-73
- Renal carcinoma antigen NY-REN-3
- ush1cpst
- Usher syndrome 1C (autosomal recessive, severe)
- Usher syndrome type-1C protein