TCP1-eta Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CCT7(chaperonin containing TCP1, subunit 7 (eta)) The peptide sequence was selected from the middle region of CCT7.Peptide sequence RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR.
|
| Specificity |
This product is specific to Subunit or Isofrom: eta.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CCT7
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CCT7 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TCP1-eta Antibody
- CCTETA
- CCT-eta
- CCTH
- chaperonin containing TCP1, subunit 7 (eta)
- eta subunit
- HIV-1 Nef interacting protein
- HIV-1 Nef-interacting protein
- MGC110985
- Nip7-1
- T-complex protein 1 subunit eta
Background
CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date.