STT3B Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (93%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
STT3B
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for STT3B Antibody
- FLJ90106
- homolog of yeast STT3
- Oligosaccharyl transferase subunit STT3B
- SIMPEC 2.4.1.119
- source of immunodominant MHC associated peptides
- Source of immunodominant MHC-associated peptides homolog
- STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae)
- STT3-Bdolichyl-diphosphooligosaccharide–protein glycosyltransferase subunit STT3B