SPARC-like 1/SPARCL1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VHENENIGTTEPGEHQEAKKAENSSNEEETSSEGNMRVHAVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPT
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SPARCL1
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for SPARC-like 1/SPARCL1 Antibody
- Hevin
- High endothelial venule protein
- MAST 9
- MAST9
- PIG33
- proliferation-inducing protein 33
- SC1
- SPARC like 1
- SPARCL1
- SPARC-like 1 (hevin)
- SPARC-like 1 (mast9, hevin)
- SPARC-like 1
- SPARC-like protein 1