SMARCD3 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPA
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (100%). Backed by our 100% Guarantee.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SMARCD3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for SMARCD3 Antibody
- 60 kDa BRG-1/Brm-associated factor subunit C
- 60kDa BRG-1/Brm associated factor subunit c
- BAF60Cchromatin remodeling complex BAF60C subunit
- BRG1-associated factor 60C
- CRACD3
- mammalian chromatin remodeling complex BRG1-associated factor 60C
- MGC111010
- Rsc6p
- subfamily d, member 3
- SWI/SNF complex 60 kDa subunit C
- SWI/SNF related, matrix associated, actin dependent regulator of chromatin
- SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3
- Swp73-like protein