Product: Nomifensine (maleate)
SLC22A12 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLC22A12(solute carrier family 22 (organic anion/urate transporter), member 12) The peptide sequence was selected from the N terminal of SLC22A12. Peptide sequence SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALL
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC22A12
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SLC22A12 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLC22A12 Antibody
- OATL4
- Organic anion transporter 4-like protein
- Renal-specific transporter
- RSTmember 12
- solute carrier family 22 (organic anion/urate transporter), member 12
- URAT1
- URAT1Urate anion exchanger 1
- urate transporter 1
Background
SLC22A12 is required for efficient urate re-absorption in the kidney. SLC22A12 regulates blood urate levels. SLC22A12 mediates saturable urate uptake by facilitating the exchange of urate against organic anions.The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene.