Product: Alverine (citrate)
SDF4 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DQDGDKQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTAEEPQSYMDLRRAPPLSNN
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SDF4
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/Immunofluorescence 1 – 4 ug/ml
- Immunohistochemistry 1:200 – 1:500
- Immunohistochemistry-Paraffin 1:200 – 1:500
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
| Control Peptide |
| SDF4 Protein (NBP2-47284PEP) |
|
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for SDF4 Antibody
PMID: 22902539
Product: (-)-Epicatechin gallate
SDF4 Antibody Summary
| Immunogen |
This antibody is specific for the C Terminus Region of the target protein.
|
| Specificity |
This product is specific for Human SDF4.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SDF4
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
| Application Notes |
This antibody is useful in ELISA and Immunohistochemistry-Paraffin.
|
| Publications |
| Read Publications using 22550002. |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
Manufactured by SDIXs proprietary Genomic Antibody Technology™. GAT FAQs.
Alternate Names for SDF4 Antibody
Background
SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment (By similarity) Isoform 5 may be involved in the exocytosis of zymogens by pancreatic acini
PMID: 26387946