Product: Vinflunine (Tartrate)
SCD-1 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SCD
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/Immunofluorescence 1 – 4 ug/ml
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:50-1:200
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
|
| Control Peptide |
| SCD-1 Recombinant Protein Antigen (NBP1-84749PEP) |
|
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for SCD-1 Antibody
PMID: 17202480
Product: VO-Ohpic (trihydrate)
SCD-1 Antibody Summary
| Immunogen |
Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3.
|
| Clonality |
Polyclonal
|
| Host |
Goat
|
| Gene |
SCD
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Flow Cytometry
- Immunohistochemistry 5 – 10 ug/ml
- Immunohistochemistry-Paraffin 1:10-1:500
- Peptide ELISA detection limit 1:64000
|
| Application Notes |
WB: Preliminary experiments gave an approx 30kDa band in Human Adipose, Brain and Liver lysates after 0.3 ug/ml antibody staining. Please note that currently we cannot find an explanation in the literature for the band we observe given the calculated size of 41.5kDa according to NP_005054.3. The 30kDa band was successfully blocked by incubation with the immunizing peptide.
IHC: In paraffin embedded Human Liver shows textured cytoplam staining in hepatocytes.
Flow Cytometry: Exclusively staining of HepG2 when mixed with Peripheral Blood Lymphocytes.
|
| Positive Control |
| SCD-1 Lysate (NBL1-15724) |
|
|
| Publications |
| Read Publication using NB100-2476. |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
0.5 mg/ml Tris (pH 7.3) and 0.5% BSA
|
| Preservative |
0.02% Sodium Azide
|
| Concentration |
0.5 mg/ml
|
| Purity |
Immunogen affinity purified
|
Notes
Please note, this antibody is considered Innovators Grade. Innovators Grade antibodies are generally unvalidated and require additional characterization for most new species/applications. Novus has made these antibodies available through our Innovators Reward program. Complete an online review with image, detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product. Please contact us at
[email protected] for more details.
Alternate Names for SCD-1 Antibody
PMID: 16364896