Product: Orphenadrine (hydrochloride)
RNASEH2A Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RNASEH2A (ribonuclease H2, subunit A) The peptide sequence was selected from the middle region of RNASEH2A.Peptide sequence AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE.
|
| Specificity |
This product is specific to Subunit or Isofrom: A.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RNASEH2A
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RNASEH2A and was validated on Western Blot and immunohistochemistry-paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RNASEH2A Antibody
- AGS4RNase H2 subunit A
- Aicardi-Goutieres syndrome 4 protein
- Aicardi-Goutieres syndrome 4
- JUNB
- ribonuclease H2 subunit A
- ribonuclease H2, large subunit
- ribonuclease H2, subunit A
- Ribonuclease HI large subunit
- Ribonuclease HI subunit A
- ribonuclease HI, large subunit
- RNase H(35)
- RNASEHIEC 3.1.26.4
- RNHIARNase HI large subunit
- RNHL
Background
Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.