RCAN3 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:LRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEALFTIYDD
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RCAN3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for RCAN3 Antibody
- Down syndrome candidate region 1-like 2
- Down syndrome critical region gene 1-like 2
- DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5
- hRCN3
- Myocyte-enriched calcineurin-interacting protein 3
- RCAN family member 3
- RCN3
- regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2
- regulator of calcineurin 3 isoform 1b2,34,5
- regulator of calcineurin 3 isoform 1c2,34,5
- regulator of calcineurin 3 isoform 1c3,45,calcipressin-3
- Regulator of calcineurin 3