RABGGTA Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RABGGTA(Rab geranylgeranyltransferase, alpha subunit) The peptide sequence was selected from the N terminal of RABGGTA (NP_878256). Peptide sequence ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL.
|
| Specificity |
This product is specific to Subunit or Isofrom: alpha.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RABGGTA
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against RABGGTA and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RABGGTA Antibody
- EC 2.5.1.60
- Geranylgeranyl transferase type II subunit alpha
- geranylgeranyl transferase type-2 subunit alpha
- protein prenyltransferase alpha subunit repeat containing 3
- PTAR3
- Rab geranylgeranyltransferase subunit alpha
- Rab geranyl-geranyltransferase subunit alpha
- Rab geranylgeranyltransferase, alpha subunit
- Rab GG transferase alpha
- Rab GGTase alpha
Background
RABGGTA belongs to the protein prenyltransferase subunit alpha family and contains 6 PFTA repeats. RABGGTA catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.