Product: 8-Aminocephalosporanic acid
Pancreatic Lipase Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PNLIP (pancreatic lipase) The peptide sequence was selected from the C terminal of PNLIP. Peptide sequence GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PNLIP
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against PNLIP and was validated on Western Blot and immunohistochemistry-paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Pancreatic Lipase Antibody
- EC 3.1.1.21
- EC 3.1.1.3
- pancreatic lipasepancreatic triacylglycerol lipase
- PL
- PTL
- triacylglycerol acylhydrolase
Background
PNLIP is a member of the lipase gene family. PNLIP is a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. It is expressed specifically in the pancreas.