PLUNC Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PLUNC(palate, lung and nasal epithelium carcinoma associated) The peptide sequence was selected from the middle region of PLUNC (NP_057667). Peptide sequence GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
BPIFA1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
From PBS.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PLUNC Antibody
- bA49G10.5
- BPIFA1
- ligand-binding protein RYA3
- LPLUNC3
- Lung-specific protein X
- LUNX
- LUNXNASG
- Nasopharyngeal carcinoma-related protein
- Palate lung and nasal epithelium clone protein
- palate, lung and nasal epithelium associated
- palate, lung and nasal epithelium carcinoma associated
- PLUNC
- protein Plunc
- Secretory protein in upper respiratory tracts
- SPLUNC1
- SPLUNC1SPURT
- tracheal epithelium enriched protein
- Tracheal epithelium-enriched protein
- Von Ebner protein Hl
Background
PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this gene is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3 UTR have been detected, but the full-length nature of only two is known.