Product: Mepivacaine (hydrochloride)
PABPC4 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNP
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PABPC4
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100 – 1:250
- Immunocytochemistry/Immunofluorescence 1-4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
| Control Peptide |
| PABPC4 Recombinant Protein Antigen (NBP2-58575PEP) |
|
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for PABPC4 Antibody
PMID: 24813396
Product: Prednisolone (23-acetate)
PABPC4 Antibody Summary
| Immunogen |
Recombinant protein encompassing a sequence within the center region of human PABPC4. The exact sequence is proprietary.
|
| Localization |
Cytoplasm
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PABPC4
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:3000
- Immunohistochemistry 10 – 1:500
- Immunohistochemistry-Paraffin 1:100-1:1000
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
70 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
0.1M Tris (pH 7.0), 0.1M Glycine and 20% Glycerol
|
| Preservative |
0.01% Thimerosal
|
| Concentration |
0.6 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for PABPC4 Antibody
Background
Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. PABPC4 was also identified as an antigen, APP1 (activated-platelet protein-1), expressed on thrombin-activated rabbit platelets. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
PMID: 25888236