Product: Taurocholic Acid (sodium hydrate)
NSF Antibody Summary
| Immunogen |
Synthetic peptides corresponding to NSF(N-ethylmaleimide-sensitive factor) The peptide sequence was selected from the C terminal of NSF.Peptide sequence STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NSF
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against NSF and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for NSF Antibody
- EC 3.6.4.6
- NEM-sensitive fusion protein
- N-ethylmaleimide-sensitive factor
- N-ethylmaleimide-sensitive factor-like protein
- N-ethylmaleimide-sensitive fusion protein
- SKD2
- vesicle-fusing ATPase
- Vesicular-fusion protein NSF
Background
The functions of NSF remain unknown.