This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK

Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

IgG

Polyclonal

Rabbit

MSH5

Affinity purified

Test in a species/application not listed above to receive a full credit towards a future purchase.

Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Peptide with sequence GDLHCEIRDQET corresponding to internal region according to NP_751897.1, NP_002432.1.

internal region

This antibody is expected to recognise three reported isoforms ( NP_079535.3 ; NP_751897.1; NP_002432.1); Reported variants NP_751898.1 and NP_002432.1 represent identical protein.

Polyclonal

Goat

MSH5

Immunogen affinity purified

Test in a species/application not listed above to receive a full credit towards a future purchase.

WB: Preliminary experiments gave an approx. 38 kDa band in human testis, tonsil and thymus lysates after 0.1 ug/ml antibody staining. Please note that currently we cannot find an explanation in the literature for the band we observe given the calculated size of 92.9 kDa band according to the smallest reported isoform NP_002432.1. The 38 kDa band was successfully blocked by incubation with the immunizing peptide. IHC-P: Human testis shows nuclear staining in spermatocytes.