MSH2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to MSH2(mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)) The peptide sequence was selected from the N terminal of MSH2.Peptide sequence GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MSH2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against MSH2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MSH2 Antibody
- COCA1
- DNA mismatch repair protein Msh2
- FCC1
- hMSH2
- HNPCC
- HNPCC1
- HNPCC1mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1)
- LCFS2
- MSH2
- mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
- MutS protein homolog 2
Background
MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.