MS4A1/CD20 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:ENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSP
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MS4A1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for MS4A1/CD20 Antibody
- B1
- B-lymphocyte antigen CD20
- B-lymphocyte cell-surface antigen B1
- B-lymphocyte surface antigen B1
- Bp35
- Bp35MGC3969
- CD20 antigen
- CD20 receptor
- CD20
- CD20S7
- CVID5
- LEU-16
- Leukocyte surface antigen Leu-16
- Ly-44
- Membrane-spanning 4-domains subfamily A member 1
- membrane-spanning 4-domains, subfamily A, member 1
- MS4A1
- MS4A2
- S7