MRP2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to Abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2) The peptide sequence was selected from the middle region of Abcc2 (NP_038834).Peptide sequence TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
Abcc2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against Abcc2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW |
174 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MRP2 Antibody
- ATP-binding cassette, sub-family C (CFTR/MRP), member 2
- Canalicular multidrug resistance protein
- canalicular multispecific organic anion transporter 1
- CMOAT1
- CMOATABC30
- cMRP
- DJS
- KIAA1010
- MRP2ATP-binding cassette sub-family C member 2
- Multidrug resistance-associated protein 2
Background
Abcc2 mediates hepatobiliary excretion of numerous organic anions. Abcc2 may function as a cellular cisplatin transporter.