MBNL2 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the middle region of human MBNL2The immunogen for this antibody is MBNL2. Peptide sequence ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MBNL2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against MBNL2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MBNL2 Antibody
- DKFZp781H1296
- MBLL39Muscleblind-like protein 1
- MBLLMGC120628
- MGC120625
- MGC120626
- MLP1
- muscleblind-like 2 (Drosophila)
- muscleblind-like protein 2
- Muscleblind-like protein-like 39
- Muscleblind-like protein-like
- PRO2032