Leptin/OB Antibody Summary
| Immunogen |
Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected form the N terminal of LEP. Peptide sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
LEP
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against LEP and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Leptin/OB Antibody
- FLJ94114
- LEP
- leptin (murine obesity homolog)
- leptin (obesity homolog, mouse)
- Leptin
- OB
- Obese protein
- obese, mouse, homolog of
- Obesity factor
- OBOBS
Background
LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regula