LKB1/STK11 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to STK11(serine/threonine kinase 11) The peptide sequence was selected from the N terminal of STK11. Peptide sequence TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
STK11
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against STK11 and was validated on Western Blot and immunohistochemistry-P
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for LKB1/STK11 Antibody
- EC 2.7.11.1
- LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome)
- LKB1
- PJS polarization-related protein LKB1
- PJS
- Renal carcinoma antigen NY-REN-19
- serine/threonine kinase 11
- serine/threonine-protein kinase 11
- Serine/threonine-protein kinase LKB1
- STK11
Background
STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.