Product: Elacestrant (dihydrochloride)
KCNE1 Antibody (5B12) Summary
| Immunogen |
KCNE1 (NP_000210 67 a.a. – 129 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
|
| Specificity |
KCNE1 (5B12)
|
| Isotype |
IgG1 Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
KCNE1
|
| Purity |
IgG purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
IgG purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for KCNE1 Antibody (5B12)
- Delayed rectifier potassium channel subunit IsK
- FLJ18426
- FLJ38123
- IKs producing slow voltage-gated potassium channel subunit beta Mink
- ISK
- Isk-related subfamily, member 1
- JLNS2FLJ94103
- LQT2/5
- MGC33114
- Minimal potassium channel
- MinK
- potassium voltage-gated channel, Isk-related family, member 1
- voltage gated potassiun channel accessory subunit
Background
The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.