IFI44L Antibody Summary
| Immunogen |
Synthetic peptides corresponding to IFI44L(interferon-induced protein 44-like) The peptide sequence was selected from the N terminal of IFI44L.Peptide sequence MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
IFI44L
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for IFI44L Antibody
- C1orf29
- chromosome 1 open reading frame 29
- GS3686
- interferon-induced protein 44-like
Background
The function remains known.