HISPPD1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: AKGCEEDKNLPSGYGYRPASRENEGRRPFKIDNDDEPHTSKRDEVDRAVILFKPMVSEPIHIHRKSPLPRSRKTATND
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PPIP5K2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (87%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for HISPPD1 Antibody
- diphosphoinositol pentakisphosphate kinase 2FLJ21506
- EC 2.7.4.21
- EC 2.7.4.24
- HISPPD1histidine acid phosphatase domain containing 1
- Histidine acid phosphatase domain-containing protein 1
- hsVIP2
- inositol heptaphosphate kinase 2
- inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
- InsP6 and PP-IP5 kinase 2
- KIAA0433FLJ23463
- VIP1 homolog 2
- VIP2IP7K2