Product: EX-527 (R-enantiomer)

FUSIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SRSF10
Purity
Immunogen affinity purified
Innovators Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Learn about the Innovators Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 – 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FUSIP1 Antibody

  • 40 kDa SR-repressor protein
  • FLJ43846
  • FUS interacting protein (serine-arginine rich) 1
  • FUS-interacting protein (serine-arginine rich) 2
  • FUS-interacting serine-arginine-rich protein 1
  • FUSIP1DKFZp686H0644
  • FUSIP2
  • neural-salient SR protein
  • NSSR
  • serine/arginine-rich splicing factor 10
  • serine-arginine repressor protein (40 kDa)
  • SFRS13
  • SFRS13A
  • Splicing factor SRp38
  • splicing factor, arginine/serine-rich 13
  • Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
  • SR splicing factor 10
  • SRp38
  • SRrp40TLS-associated protein with SR repeats
  • TASR1TLS-associated SR protein
  • TASR2FUS interacting protein (serine/arginine-rich) 1
  • TASRFLJ30749
  • TLS-associated protein TASR
  • TLS-associated serine-arginine protein 1
  • TLS-associated serine-arginine protein 2
  • TLS-associated serine-arginine protein

PMID: 23403695

Product: Imazalil

FUSIP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to FUSIP1(FUS interacting protein (serine/arginine-rich) 1) The peptide sequence was selected from the C terminal of FUSIP1.Peptide sequence TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS.
Clonality
Polyclonal
Host
Rabbit
Gene
SRSF10
Purity
Immunogen affinity purified
Innovators Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Learn about the Innovators Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against FUSIP1 and was validated on Western Blot and immunohistochemistry-p

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FUSIP1 Antibody

  • 40 kDa SR-repressor protein
  • FLJ43846
  • FUS interacting protein (serine-arginine rich) 1
  • FUS-interacting protein (serine-arginine rich) 2
  • FUS-interacting serine-arginine-rich protein 1
  • FUSIP1DKFZp686H0644
  • FUSIP2
  • neural-salient SR protein
  • NSSR
  • serine/arginine-rich splicing factor 10
  • serine-arginine repressor protein (40 kDa)
  • SFRS13
  • SFRS13A
  • Splicing factor SRp38
  • splicing factor, arginine/serine-rich 13
  • Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
  • SR splicing factor 10
  • SRp38
  • SRrp40TLS-associated protein with SR repeats
  • TASR1TLS-associated SR protein
  • TASR2FUS interacting protein (serine/arginine-rich) 1
  • TASRFLJ30749
  • TLS-associated protein TASR
  • TLS-associated serine-arginine protein 1
  • TLS-associated serine-arginine protein 2
  • TLS-associated serine-arginine protein

Background

FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing.This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

PMID: 25474141