Product: GNF179 (Metabolite)
FOXO4 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
FOXO4
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100 – 1:250
- Immunocytochemistry/Immunofluorescence 1-4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
| Control Peptide |
| FOXO4 Recombinant Protein Antigen (NBP2-58083PEP) |
|
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for FOXO4 Antibody
PMID: 8020570
Product: Diphenidol (hydrochloride)
FOXO4 Antibody Summary
| Immunogen |
Antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human FOXO4. The immunogen is located within amino acids 30 – 80 of FOXO4.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
FOXO4
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100-1:2000
- ELISA 1:100-1:2000
- Immunocytochemistry/Immunofluorescence 1:10-1:2000
- Immunofluorescence
|
| Control Peptide |
| FOXO4 Peptide (NBP1-77174PEP) |
|
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS
|
| Preservative |
0.02% Sodium Azide
|
| Concentration |
1 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for FOXO4 Antibody
Background
FOXO4 is a ubiquitously expressed protein member of a subfamily of the forkhead homeotic gene family of transcription factors and shuttles between the cytoplasm and nucleus. FOXO transcription factors are key players of cell fate decisions, metabolism, stress resistance, tumor suppression and are regulated by growth factors, oxidative stress or nutrient deprivation. In the absence of PI3K/AKT activation, FOXO4 localizes in the nucleus where it functions as a transcription factor. FOXO4 can also be phosphorylated by JNK following induction of reactive oxygen species (ROS), resulting in transcriptional activation and the induction of a negative feedback mechanism to counteract the ROS. It is through this mechanism that FOXO4 is thought to sensitize cancer cells to doxorubicin-mediated toxicity.
PMID: 24347635